Stir-fry
A quick and colorful stir-fry with tender meat, crisp vegetables, and a savory sauce. Perfect for a weeknight dinner.
- Total time
- 25 min
- Servings
- 4
- Calories
- 280
- Protein
- 28g
quickweeknightasiandairy-freechickencrisptenderweeknight dinner
Ingredients
- 1 lb chicken breast
- 2 medium bell pepper
- 2 medium carrot
- 1 medium onion
- 3 stalks green onion
- 3 tbsp soy sauce
- 2 tbsp vegetable oil
- 1 tbsp cornstarch
Instructions
- 1
Slice chicken into thin strips; toss with 1 tbsp soy sauce and cornstarch. Set aside.
- 2
Cut bell peppers, carrots, and onion into bite-sized pieces; slice green onions.
- 3
Heat 1 tbsp oil in a wok or large skillet over high heat. Add chicken and stir-fry until golden, about 3-4 minutes. Remove.
- 4
Add remaining oil, then vegetables. Stir-fry until crisp-tender, 3-5 minutes.
- 5
Return chicken to pan. Add remaining soy sauce and toss everything together for 1 minute.
- 6
Garnish with green onions and serve hot.
Tools you’ll need
- wok or large skillet
- cutting board
- knife
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
