CookSnap is coming soon — Join the waitlist →
Back to recipes

Sticky Honey BBQ Wings

Chicken wings tossed with BBQ sauce and honey, roasted until caramelized and sticky. Serve with celery sticks and dipping sauce for a classic weeknight dinner.

Total time
25 min
Servings
4
Calories
485
Protein
38g
Sticky Honey BBQ Wings
comfortcasualamericanchickencrispystickytenderweeknight

Ingredients

  • 2 lbs chicken wings
  • ¾ cup bbq sauce
  • ¼ cup honey

Instructions

  1. 1

    Pat wings dry with paper towels and toss with salt and pepper.

  2. 2

    Spread wings on a sheet pan and roast at 425°F for 15 minutes.

  3. 3

    Whisk BBQ sauce and honey together, then pour over wings and toss well.

  4. 4

    Roast another 8 minutes until sauce is sticky and edges caramelize.

  5. 5

    Serve hot with celery sticks and a side dipping sauce of your choice.

Tools you’ll need

  • sheet pan
  • paper towels
  • small bowl for mixing
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.