CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spinach Fatayer

Crispy, golden Lebanese spinach hand pies with a bright lemon-garlic filling. Bake or air-fry store-bought phyllo for a weeknight shortcut that tastes homemade.

Total time
20 min
Servings
4
Calories
298
Protein
11g
Spinach Fatayer
casualfreshlebanesevegetarianvegetariancrispyflakyweeknight

Ingredients

  • 6 cups fresh spinach, roughly chopped
  • 8 sheets phyllo dough (thawed if frozen)
  • ½ medium onion, finely diced
  • ¾ cup feta cheese, crumbled
  • 1 whole lemon (zested + juiced)
  • 2 cloves garlic, minced
  • ¼ cup pine nuts (optional, toasted)

Instructions

  1. 1

    Heat 2 tbsp olive oil in a large skillet over medium-high heat for 90 seconds.

  2. 2

    Add onion and cook for 2 minutes until softened and fragrant.

  3. 3

    Add spinach by handfuls, stirring, until completely wilted and any liquid cooks off, ~4 minutes.

  4. 4

    Stir in feta, garlic, lemon zest, and lemon juice. Season with salt and pepper. Remove from heat.

  5. 5

    Lay one phyllo sheet on a work surface. Brush lightly with olive oil. Fold in half lengthwise.

  6. 6

    Spoon 2–3 tbsp spinach filling onto one end. Fold into a triangle, tucking edges as you go. Repeat with remaining phyllo and filling.

  7. 7

    Arrange triangles seam-side down on a lined baking sheet. Brush tops lightly with olive oil.

  8. 8

    Bake at 400°F for 10–12 minutes until golden and crispy. Sprinkle pine nuts if using. Serve warm.

Tools you’ll need

  • large skillet (12-inch)
  • baking sheet
  • parchment paper
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.