CookSnap is coming soon — Join the waitlist →

Spicy Seafood Cake Skillet

Crispy Korean fish cakes tossed in a garlicky gochujang glaze with squid and vegetables. Ready in 20 minutes — the TikTok version of eomuk bokkeum.

Total time
20 min
Servings
2
Calories
240
Protein
24g
Spicy Seafood Cake Skillet
casualsatisfyingkoreanseafoodcrispytenderweeknightstir-fry

Ingredients

  • 8 oz Korean fish cakes (eomuk), cut into 2-inch pieces
  • 6 oz squid, cleaned and sliced into rings
  • 2 tbsp gochujang (Korean red chili paste)
  • 1 tbsp soy sauce
  • ½ tbsp sugar
  • 3 cloves garlic, minced
  • 1 whole scallion, sliced (white and green parts separated)

Instructions

  1. 1

    Stir together gochujang, soy sauce, sugar, and 2 tbsp water until smooth.

  2. 2

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 90 seconds.

  3. 3

    Add fish cakes and squid. Sear without stirring for 2 minutes until edges start to brown and curl.

  4. 4

    Add minced garlic and white scallion parts. Stir constantly for 30 seconds until fragrant.

  5. 5

    Pour in the gochujang sauce and toss everything until coated, about 2 minutes. Sauce should glaze and thicken slightly.

  6. 6

    Top with green scallion slices and serve immediately over rice or with crusty bread.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.