CookSnap is coming soon — Join the waitlist →

Spicy Miso Soup

A warming Japanese-inspired broth with deep umami flavor, finished with a spicy kick from chili oil and fresh ginger. Ready in 20 minutes and endlessly customizable.

Total time
20 min
Servings
4
Calories
95
Protein
7g
Spicy Miso Soup
comfortfreshjapanesevegetarianvegansilkyweeknightcozy

Ingredients

  • 4 cups vegetable or kombu dashi (or water)
  • 3 tbsp white or red miso paste
  • 1 tbsp fresh ginger, minced
  • 1 tbsp chili-garlic paste or sriracha
  • 8 oz tofu, cubed
  • 2 stalks scallions, sliced
  • ½ sheet nori sheets, torn
  • ½ tsp soy sauce

Instructions

  1. 1

    Bring dashi or water to a gentle simmer in a medium pot over medium heat, ~3 minutes.

  2. 2

    Add ginger and chili-garlic paste. Stir well and simmer for 1 minute until fragrant.

  3. 3

    Add tofu cubes and soy sauce. Simmer gently for 3 minutes; tofu should heat through.

  4. 4

    Whisk miso paste in a small bowl with 2 tbsp of warm broth until smooth; no lumps.

  5. 5

    Pour miso mixture into the pot. Stir gently and simmer for 2 minutes; do not boil hard.

  6. 6

    Divide soup into bowls. Top with scallions and torn nori. Serve immediately.

Tools you’ll need

  • medium pot (4–6 quart)
  • small bowl
  • whisk
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.