CookSnap is coming soon — Join the waitlist →

Quick Ramen Broth from Scratch

A fragrant, umami-rich broth built on kombu, ginger, and garlic in under 45 minutes. Perfect base for noodles, vegetables, and toppings.

Total time
45 min
Servings
4
Calories
35
Protein
1g
Quick Ramen Broth from Scratch
comfortcozyjapanesevegetarianvegandairy-freesmoothweeknight

Ingredients

  • 8 cups water
  • 2 oz kombu (dried kelp)
  • 3 tbsp ginger, peeled and sliced
  • 6 whole garlic cloves, smashed
  • 3 tbsp soy sauce
  • 2 tbsp mirin
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Wipe kombu with a damp cloth to remove surface dust—do not rinse.

  2. 2

    Pour water into a large pot and add kombu. Heat over medium until steaming but not quite boiling, ~8 minutes.

  3. 3

    Remove from heat just before the first bubble breaks. Remove kombu and discard.

  4. 4

    Return pot to medium heat. Add ginger and garlic. Simmer gently for 20 minutes until broth is fragrant.

  5. 5

    Stir in soy sauce and mirin. Taste and adjust salt and pepper.

  6. 6

    Strain through a fine-mesh sieve into a bowl. Discard solids.

  7. 7

    Use broth immediately for ramen, or cool and refrigerate up to 5 days.

Tools you’ll need

  • large pot (6-quart or larger)
  • fine-mesh sieve or strainer
  • spoon for stirring
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.