Spicy Michelada with Chili-Lime Rim
A tangy, spicy beer cocktail with a chili-salt rim, fresh lime juice, and Mexican hot sauce. Serve ice-cold with tortilla chips and salsa verde on the side.
- Total time
- 5 min
- Servings
- 2
- Calories
- 148
- Protein
- 1g
refreshingcelebratorymexicanvegetarianvegancrispyweeknightcasual
Ingredients
- 24 oz lager or Mexican beer (like Corona or Modelo)
- 2 tbsp fresh lime juice
- 1 tbsp hot sauce (like Valentina or Tabasco)
- ½ tbsp Worcestershire sauce
- 2 tbsp chili powder or Tajín seasoning
- 1 whole lime wedge, for rim
Instructions
- 1
Rim two chilled glasses by running a lime wedge around the edge, then dip into chili powder mixed with a pinch of salt.
- 2
Fill glasses with ice, then pour 12 oz beer into each glass.
- 3
Add 1 tbsp lime juice, 0.5 tbsp hot sauce, and 0.25 tbsp Worcestershire to each glass.
- 4
Stir gently with a bar spoon or long spoon until combined and chilled.
- 5
Serve immediately with tortilla chips and salsa verde on the side.
Tools you’ll need
- two chilled glasses or pint glasses
- bar spoon or long spoon
- small dish or plate for chili powder rim
- ice
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
