CookSnap is coming soon — Join the waitlist →

Spanish Salad with Flatbread

Crisp lettuce, tomato, cucumber, and egg tossed with a bright sherry vinaigrette and served alongside warm flatbread. A light, fresh meal that comes together in under 15 minutes.

Total time
15 min
Servings
2
Calories
385
Protein
12g
Spanish Salad with Flatbread
lightfreshspanishvegetarianeggscrispytenderweeknight

Ingredients

  • 4 cups romaine lettuce or butter lettuce, chopped
  • 1 large tomato, diced
  • 1 medium cucumber, diced
  • 2 large eggs
  • 2 tbsp sherry vinegar
  • 5 tbsp olive oil
  • 2 pieces flatbread, pita, or naan

Instructions

  1. 1

    Bring a small pot of salted water to a boil. Gently add eggs and cook for 7 minutes until firm but yolk still creamy.

  2. 2

    While eggs cook, whisk sherry vinegar, olive oil, salt, and pepper in a small bowl until emulsified.

  3. 3

    Toss lettuce, tomato, and cucumber in a large bowl with the dressing until everything is coated evenly.

  4. 4

    Transfer salad to plates. Peel and halve the cooled eggs, then nestle them on top of each portion.

  5. 5

    Warm flatbread in a dry skillet over medium heat, 1 minute per side, until soft and pliable.

  6. 6

    Serve salad and eggs with warm flatbread on the side.

Tools you’ll need

  • small pot
  • large bowl
  • small whisk
  • dry skillet
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.