Spanish Mixed Salad with Tuna & Egg
A bright, no-cook Spanish salad loaded with crispy lettuce, hard-boiled egg, canned tuna, olives, and tomato—tossed in a simple red wine vinegar dressing. Ready in 10 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 22g
freshlightspanishvegetarianeggscrispytenderweeknight
Ingredients
- 4 cups, chopped romaine or mixed lettuce
- 2 whole hard-boiled eggs
- 1 can (5 oz), drained canned tuna in water
- 1 cup, halved cherry tomatoes
- ½ cup green olives, pitted
- 2 tbsp red wine vinegar
- 4 tbsp olive oil
Instructions
- 1
Place lettuce in a large bowl. Top with chopped egg, flaked tuna, tomatoes, and olives.
- 2
Whisk red wine vinegar and olive oil together in a small bowl with a pinch of salt and pepper.
- 3
Pour dressing over salad and toss gently until coated.
- 4
Serve immediately.
Tools you’ll need
- large mixing bowl
- small bowl
- whisk
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
