CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spanakopita

A classic Greek spinach and feta pie wrapped in crispy phyllo dough with herbs and aromatics. Golden, flaky, and savory—perfect as an appetizer or light meal.

Total time
50 min
Servings
8
Calories
285
Protein
9g
Spanakopita
greekvegetarianspinachfetaphyllo dough

Ingredients

  • 1 lb fresh spinach
  • 1 cup feta cheese, crumbled
  • 1 medium onion, diced
  • 2 cloves garlic, minced
  • 3 tbsp fresh dill, chopped
  • 2 tbsp fresh parsley, chopped
  • 1 large egg
  • 10 sheets phyllo dough sheets
  • ½ cup olive oil
  • ½ tsp salt
  • ¼ tsp black pepper
  • ⅛ tsp nutmeg

Instructions

  1. 1

    Preheat oven to 375°F. Wash and roughly chop the fresh spinach.

  2. 2

    Heat 2 tbsp olive oil in a large skillet over medium heat. Sauté diced onion for 3 minutes until softened.

  3. 3

    Add minced garlic and cook 30 seconds until fragrant. Add spinach in batches, stirring until fully wilted (about 5 minutes total).

  4. 4

    Transfer spinach mixture to a colander and press to remove excess moisture. Let cool slightly, then transfer to a mixing bowl.

  5. 5

    Stir crumbled feta, fresh dill, parsley, egg, salt, pepper, and nutmeg into the cooled spinach mixture. Taste and adjust seasoning.

  6. 6

    Brush a 9x13-inch baking dish with olive oil. Layer 5 phyllo sheets in the dish, brushing each lightly with olive oil between layers.

  7. 7

    Spread spinach-feta filling evenly over the phyllo base.

  8. 8

    Layer remaining 5 phyllo sheets on top, brushing each with olive oil. Fold edges inward and brush the top generously with olive oil.

  9. 9

    With a sharp knife, score the top into 8 equal portions. Bake for 25-30 minutes until golden brown and crispy.

  10. 10

    Cool for 5 minutes before serving. Cut along scored lines and serve warm or at room temperature.

Tools you’ll need

  • large skillet
  • colander
  • mixing bowl
  • 9x13-inch baking dish
  • pastry brush
  • sharp chef's knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.