Custrd is out on the App Store — Download it free →
Back to recipes

Smashed Chicken with Rice

Crispy fried chicken is smashed and served over white rice with a spicy sambal, fresh cucumber, tomato, and crunchy fried shallots. A simple Indonesian-inspired meal that's big on flavor.

Total time
35 min
Servings
4
Calories
650
Protein
35g
Smashed Chicken with Rice
comfortingsatisfyingindonesiandairy-freechickencrispytenderweeknight dinner

Ingredients

  • 4 pieces chicken thighs
  • 1 teaspoon salt
  • ½ cup oil
  • 2 cups rice
  • 3 tablespoons sambal oelek
  • 1 medium cucumber
  • 1 medium tomato
  • 2 tablespoons fried shallots

Instructions

  1. 1

    Season chicken thighs with salt and let sit for 10 minutes.

  2. 2

    Heat oil in a skillet over medium-high. Fry chicken until golden and cooked through, about 6-7 minutes per side.

  3. 3

    Remove chicken and drain on paper towels. Smash each piece with a heavy spatula or pestle until flattened but still intact.

  4. 4

    Cook rice according to package directions; keep warm.

  5. 5

    Slice cucumber and tomato into thin rounds.

  6. 6

    Serve rice topped with smashed chicken, sambal, cucumber, tomato, and fried shallots.

  7. 7

    Add extra sambal or lime if you like more heat.

Tools you’ll need

  • skillet
  • heavy spatula or pestle
  • pot for rice
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.