Skillet Kielbasa & Potatoes
Sliced kielbasa and diced potatoes sear together in one skillet with paprika for a smoky, satisfying weeknight dinner. Ready in under 20 minutes with minimal cleanup.
- Total time
- 18 min
- Servings
- 2
- Calories
- 520
- Protein
- 28g
comfortquickamericanporkcrispytenderweeknightmain-dish
Ingredients
- 1 lb kielbasa sausage
- 1.5 lbs potatoes, diced into 0.5-inch cubes
- 2 tbsp olive oil
- 1 tsp paprika
Instructions
- 1
Slice kielbasa into 0.5-inch rounds.
- 2
Heat olive oil in a 12-inch skillet over medium-high until shimmering.
- 3
Add diced potatoes and cook without stirring for 5 minutes until bottoms turn golden.
- 4
Stir in kielbasa slices and paprika, then cook 4 minutes until edges crisp.
- 5
Season with salt and pepper to taste.
- 6
Serve hot directly from the skillet.
Tools you’ll need
- 12-inch skillet
- cutting board
- chef's knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
