15-Min Skillet Apple Cobbler
Tender cinnamon apples with a warm buttery crumble topping, ready in 15 minutes. No rolling, no fuss — just slice, toss, and bake.
- Total time
- 15 min
- Servings
- 4
- Calories
- 285
- Protein
- 2g
comfortcozyamericanvegetariancrispytenderweeknightcozy
Ingredients
- 5 medium apples, peeled and sliced
- ½ cup sugar, divided
- ¾ cup flour
- 4 tbsp butter, cold and cubed
Instructions
- 1
Toss apple slices with half the sugar in a 10-inch cast iron skillet.
- 2
Mix flour with remaining sugar, then pinch in cold butter until mix looks sandy.
- 3
Sprinkle flour crumble over apples, covering the surface evenly.
- 4
Bake at 400°F for 12 minutes until topping is golden and apples bubble at edges.
- 5
Cool 2 minutes, then serve warm in bowls.
Tools you’ll need
- 10-inch cast iron skillet or 9x9-inch baking dish
- oven
- mixing bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
