CookSnap is coming soon — Join the waitlist →
Back to recipes

Sicilian Pizza

A crispy, thick-crust Sicilian pizza topped with tomato sauce, caramelized onions, and melted cheese. Ready in under 30 minutes with just six ingredients.

Total time
25 min
Servings
2
Calories
520
Protein
16g
Sicilian Pizza
comfortcasualitalianvegetariancrispymeltyweeknightcasual

Ingredients

  • 2 cups all-purpose flour
  • 4 tablespoons olive oil
  • 1 whole yellow onion
  • 1 cup canned crushed tomatoes
  • 1.5 cups mozzarella cheese, shredded
  • 1 teaspoon salt

Instructions

  1. 1

    Set the oven to 425°F and wait for the indicator light or beep to signal it has finished preheating, about 10 minutes.

  2. 2

    Pour 2 tablespoons of olive oil onto a 9-by-13-inch sheet pan and tilt the pan so the oil coats the entire bottom surface.

  3. 3

    In a large bowl, mix 2 cups flour and 1 teaspoon salt, then add 0.75 cup cold water and stir with a wooden spoon until a shaggy, sticky dough forms, about 1 minute.

  4. 4

    Turn the dough out onto the oiled sheet pan and press it gently with your fingertips into a 9-by-13-inch rectangle covering the entire pan.

  5. 5

    Cut the onion in half from root to tip, place cut-side down on the cutting board, then slice each half crosswise into thin rings about 1/8-inch thick.

  6. 6

    Heat 2 tablespoons of olive oil in a 10-inch skillet over medium heat until it shimmers and moves quickly when you tilt the pan, about 60 seconds.

  7. 7

    Add the sliced onions and stir once every 30 seconds until they turn golden brown and soft, about 8 minutes.

  8. 8

    Spread 1 cup crushed tomatoes evenly across the dough on the sheet pan using the back of a spoon.

  9. 9

    Scatter the cooked onions evenly over the tomato sauce.

  10. 10

    Sprinkle 1.5 cups shredded mozzarella in a thin, even layer covering the entire pizza surface.

  11. 11

    Slide the sheet pan into the oven and bake until the crust is golden brown at the edges and the cheese is bubbling and starting to brown in spots, about 12 minutes.

  12. 12

    Remove the sheet pan from the oven using oven mitts and set it on a heat-safe surface.

  13. 13

    Let the pizza rest on the pan for 2 minutes, then slice into rectangles and serve warm.

Tools you’ll need

  • oven
  • 9-by-13-inch sheet pan
  • large mixing bowl
  • wooden spoon
  • cutting board
  • chef's knife
  • 10-inch skillet
  • spatula or spoon for spreading
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.