CookSnap is coming soon — Join the waitlist →
Back to recipes

Filipino Shrimp & Sweet Potato Ukoy

Crispy pan-fried fritters packed with shrimp, sweet potato, and green onion. Served with a tangy vinegar dipping sauce, these are ready in 25 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
12g
Filipino Shrimp & Sweet Potato Ukoy
casualcomfortfilipinoshrimpcrispytenderweeknightdinner

Ingredients

  • ½ lb shrimp, peeled and deveined
  • 1 medium sweet potato, grated
  • ¾ cup all-purpose flour
  • 3 stalks green onions, sliced thin
  • ½ cup water
  • 1 pinch salt and black pepper
  • ½ cup oil for frying
  • ¼ cup vinegar (white or cane)
  • 2 cloves garlic, minced

Instructions

  1. 1

    Roughly chop shrimp into 0.5-inch pieces. Squeeze excess moisture from grated sweet potato using paper towels.

  2. 2

    Whisk together flour, water, salt, and pepper until a thick batter forms. Fold in shrimp, sweet potato, and green onion.

  3. 3

    Stir vinegar and minced garlic together in a small bowl. Set aside.

  4. 4

    Heat oil in a 12-inch skillet over medium-high until a drop of batter sizzles immediately, ~2 minutes.

  5. 5

    Drop heaping tablespoons of batter into the oil without crowding. Fry until deep golden brown, ~2 minutes per side.

  6. 6

    Transfer ukoy to a paper-towel-lined plate to drain. Work in batches if needed.

  7. 7

    Serve hot ukoy with vinegar-garlic sauce on the side for dipping.

Tools you’ll need

  • box grater
  • paper towels
  • large mixing bowl
  • whisk
  • 12-inch skillet
  • slotted spoon
  • small bowl
  • kitchen thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.