Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp on Silken Tofu

A quick, comforting dish of silky tofu topped with tender shrimp and a savory sauce, finished with green onions. Ready in about 20 minutes, perfect for a light meal or side.

Total time
20 min
Servings
2
Calories
280
Protein
28g
Shrimp on Silken Tofu
comfortingasiangluten-freeshrimpsilkytenderweeknightmain

Ingredients

  • 1 block (about 14 oz) silken tofu
  • 8 oz shrimp, peeled and deveined
  • 2 tbsp soy sauce
  • 1 tsp cornstarch
  • 2 stalks green onions, sliced
  • 1 tbsp vegetable oil

Instructions

  1. 1

    Drain the 1 block silken tofu and gently slice into 1/2-inch thick pieces. Arrange on a serving plate and set aside.

  2. 2

    In a small bowl, mix 2 tbsp soy sauce, 1 tsp cornstarch, and 3 tbsp water until smooth. Set aside.

  3. 3

    Heat 1 tbsp vegetable oil in a skillet over medium-high heat. Add 8 oz shrimp and cook until pink and opaque, about 2-3 minutes per side.

  4. 4

    Pour the soy sauce mixture over the shrimp. Stir and cook until the sauce thickens and coats the shrimp, about 1 minute.

  5. 5

    Spoon the shrimp and sauce over the tofu. Garnish with 2 sliced green onions and serve warm.

Tools you’ll need

  • skillet
  • small bowl
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.