Shrimp Fritters
Crispy golden shrimp fritters made with a simple batter and breadcrumbs, perfect for a quick snack or light meal.
- Total time
- 20 min
- Servings
- 2
- Calories
- 420
- Protein
- 20g
comfortingquickFilipinoshrimpcrispytenderweeknightcasual gathering
Ingredients
- ½ lb shrimp
- ½ cup all-purpose flour
- ½ cup breadcrumbs
- 1 egg
- ½ tsp salt
- ½ cup vegetable oil
Instructions
- 1
Peel and devein the 0.5 lb shrimp, then chop into small pieces. In a bowl, mix the shrimp with 0.5 cup flour, 1 egg, and 0.5 tsp salt until well combined.
- 2
Shape the mixture into small patties, about 2 inches wide. Press each patty into 0.5 cup breadcrumbs, coating both sides evenly.
- 3
Heat 0.5 cup vegetable oil in a skillet over medium-high. Fry the fritters in batches, about 3 minutes per side, until golden brown and crispy. Drain on paper towels and serve hot.
Tools you’ll need
- skillet
- mixing bowl
- paper towels
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
