Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp and Tomato Casserole

A creamy, cheesy baked casserole with shrimp, tomatoes, and zucchini. Perfect for a cozy weeknight dinner.

Total time
35 min
Servings
4
Calories
480
Protein
30g
Shrimp and Tomato Casserole
comfortingAmericangluten freeshrimpcreamytenderweeknightcasserole

Ingredients

  • 1 lb shrimp
  • 4 medium tomatoes
  • 2 medium zucchini
  • 1 cup heavy cream
  • 1 cup shredded cheese
  • 2 tbsp olive oil
  • 3 cloves garlic
  • 1 tsp salt

Instructions

  1. 1

    Preheat oven to 375°F. Slice 2 zucchini into rounds and chop 4 tomatoes. Mince 3 garlic cloves.

  2. 2

    In a skillet over medium heat, add 2 tbsp olive oil and the minced garlic. Cook until fragrant, about 1 minute.

  3. 3

    Add the sliced zucchini and chopped tomatoes to the skillet. Cook until vegetables soften, about 5 minutes.

  4. 4

    Stir in 1 lb shrimp and 1 cup heavy cream. Season with 1 tsp salt. Simmer until shrimp turn pink, about 3 minutes.

  5. 5

    Transfer mixture to a baking dish. Sprinkle 1 cup shredded cheese evenly over the top.

  6. 6

    Bake until cheese is melted and bubbly, about 15 minutes. Let cool slightly before serving.

Tools you’ll need

  • Oven
  • Skillet
  • Baking dish
  • Knife
  • Cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.