Custrd is out on the App Store — Download it free →
Back to recipes

Shredded Pancake

A fluffy, caramelized shredded pancake that's a beloved Austrian breakfast treat. Crispy edges, tender center, and a hint of sweetness make it perfect for a cozy morning.

Total time
20 min
Servings
2
Calories
420
Protein
14g
Shredded Pancake
comfortingindulgentAustrianvegetarianeggcrispytenderweekend breakfast

Ingredients

  • 1 cup all-purpose flour
  • 3 large eggs
  • ¾ cup milk
  • 2 tbsp sugar
  • 3 tbsp butter
  • ¼ tsp salt

Instructions

  1. 1

    In a medium bowl, whisk together the 1 cup flour, 3 eggs, 0.75 cup milk, 2 tbsp sugar, and 0.25 tsp salt until smooth, about 1 minute.

  2. 2

    Melt 2 tbsp of the butter in a large nonstick skillet over medium heat. Pour in the batter and cook until the bottom is golden and set, about 4-5 minutes.

  3. 3

    Flip the pancake in pieces using a spatula, then add the remaining 1 tbsp butter. Cook for another 3-4 minutes until the pieces are golden and cooked through.

  4. 4

    Use two spatulas to tear the pancake into bite-sized shreds. Cook for 1-2 more minutes, stirring, until the shreds are caramelized and slightly crispy.

  5. 5

    Serve warm, dusted with extra sugar or a dollop of jam if desired.

Tools you’ll need

  • Large nonstick skillet
  • Mixing bowl
  • Whisk
  • Spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.