CookSnap is coming soon — Join the waitlist →

20-Min Shito Chicken

Crispy pan-fried chicken bathed in Ghanaian shito—a punchy, spicy tomato-and-chile sauce that hits sweet, hot, and savory all at once. One skillet, dinner in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
48g
20-Min Shito Chicken
comfortboldghanaianchickencrispytenderweeknightmain-dish

Ingredients

  • 1 lb chicken thighs, boneless and skinless
  • 14 oz canned whole tomatoes
  • 1 whole habanero or Scotch bonnet pepper
  • ½ medium onion, diced
  • 2 tbsp tomato paste
  • 1 tbsp ginger, minced

Instructions

  1. 1

    Pat chicken dry, then season generously with salt and black pepper on both sides.

  2. 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Sear chicken without moving for 3 minutes per side until golden brown, then transfer to a plate.

  4. 4

    In the same skillet, sauté diced onion for 2 minutes, then add minced ginger and tomato paste, stirring for 30 seconds until fragrant.

  5. 5

    Pour in canned tomatoes, add whole habanero, and bring to a simmer. Return chicken to skillet and cook for 5 minutes until chicken is cooked through.

  6. 6

    Remove from heat, discard habanero, and taste for salt and heat. Serve hot over rice or with flatbread.

Tools you’ll need

  • 12-inch cast iron or stainless steel skillet
  • plate for resting chicken
  • wooden spoon or silicone spatula
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.