CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Chicken Flautas with Lime Crema

Shredded rotisserie chicken rolled in corn tortillas, pan-fried until golden, and served with a tangy lime crema. A weeknight Tex-Mex plate that tastes like you spent hours—but doesn't.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Crispy Chicken Flautas with Lime Crema
comfortquicktex-mexchickencrispytenderweeknightmain-dish

Ingredients

  • 2 cups rotisserie chicken, shredded
  • 8 count corn tortillas (6-inch)
  • 1 cup sharp cheddar, shredded
  • 1 medium jalapeño, minced
  • ½ cup sour cream
  • 1 whole lime (zested + juiced)
  • 3 tbsp neutral oil (for frying)

Instructions

  1. 1

    Stir sour cream with lime zest, lime juice, and a pinch of salt. Set crema aside.

  2. 2

    Warm tortillas in a dry skillet 20 seconds per side so they're pliable without cracking.

  3. 3

    Toss shredded chicken with cheddar and jalapeño. Divide evenly among tortillas.

  4. 4

    Roll each tortilla tightly around the filling, tucking in the sides. Place seam-side down.

  5. 5

    Heat oil in the same skillet over medium-high until it shimmers. Fry flautas 2 minutes per side until golden and crispy.

  6. 6

    Serve hot with lime crema on the side or drizzled over top.

Tools you’ll need

  • 9-inch nonstick skillet
  • cutting board
  • knife
  • small bowl (for crema)
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.