CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Tahini Roasted Veggie Bowl

Roasted Mediterranean vegetables with warm grains and creamy tahini dressing — all from one sheet pan. Fresh, hearty, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
320
Protein
9g
Sheet-Pan Tahini Roasted Veggie Bowl
freshhealthymediterraneanvegetarianvegancrispytenderweeknight

Ingredients

  • 1.5 cups cherry tomatoes
  • 1 medium zucchini, cut into half-moons
  • 1 whole red bell pepper, cut into 1-inch chunks
  • 3 tbsp tahini
  • 1 whole lemon (juiced)
  • 1.5 cups cooked grains (quinoa, farro, or brown rice)

Instructions

  1. 1

    Toss tomatoes, zucchini, and bell pepper with 2 tbsp olive oil, salt, and pepper on a sheet pan.

  2. 2

    Spread vegetables in a single layer. Roast at 425°F for 12–14 minutes until edges brown.

  3. 3

    While vegetables roast, whisk tahini, lemon juice, 2 tbsp water, minced garlic, salt, and pepper until smooth.

  4. 4

    Warm cooked grains in a bowl or on the sheet pan during the last 2 minutes of roasting.

  5. 5

    Divide grains between bowls. Top with roasted vegetables and drizzle generously with tahini dressing.

Tools you’ll need

  • sheet pan
  • large bowl
  • whisk
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.