CookSnap is coming soon — Join the waitlist →
Back to recipes

Mediterranean Grain Bowl

A colorful, protein-packed bowl of warm quinoa topped with roasted chickpeas, fresh cucumber, cherry tomatoes, and a bright lemon-olive oil drizzle. Ready in 25 minutes with minimal cleanup.

Total time
25 min
Servings
2
Calories
438
Protein
15g
Mediterranean Grain Bowl
healthylightmediterraneanvegetarianveganchickpeascrispytender

Ingredients

  • ¾ cup quinoa, uncooked
  • 1 can (15 oz) canned chickpeas, drained and patted dry
  • 1 cup cherry tomatoes
  • 1 medium cucumber
  • 1 whole lemon
  • 3 tablespoon olive oil

Instructions

  1. 1

    Set the oven to 400°F and wait until the indicator light tells you it has finished preheating, about 8 minutes.

  2. 2

    Pour the drained chickpeas onto a paper towel and gently pat them until they feel dry to the touch, removing any loose skins.

  3. 3

    Spread the dried chickpeas in a single layer on a sheet pan, drizzle with 1 tablespoon of olive oil, sprinkle salt and pepper over them, and toss with a spoon until all are evenly coated.

  4. 4

    Slide the sheet pan into the oven and roast the chickpeas until they turn golden brown and feel crispy when you pick one up, about 12 to 15 minutes.

  5. 5

    While the chickpeas roast, measure the quinoa into a medium pot and rinse it under cold running water for 30 seconds, stirring gently with your fingers until the water runs mostly clear.

  6. 6

    Pour 1.5 cups of water into the pot with the rinsed quinoa, add a pinch of salt, and place the pot on the stove over medium-high heat.

  7. 7

    Bring the water to a rolling boil — you'll see large bubbles breaking the surface constantly — then reduce the heat to low, cover the pot with a lid, and simmer for 12 minutes.

  8. 8

    Remove the pot from the heat and let it sit, covered, for 5 minutes so the quinoa absorbs all the remaining water.

  9. 9

    While the quinoa cooks, slice the cucumber in half lengthwise from root to tip, then lay each half cut-side down and cut crosswise into quarter-inch-thick half-moons.

  10. 10

    Cut each cherry tomato in half by placing it on the cutting board and slicing straight down through the middle.

  11. 11

    Cut the lemon in half and squeeze the juice from both halves into a small bowl using your hands or a citrus juicer.

  12. 12

    Pour the remaining 2 tablespoons of olive oil into the bowl with the lemon juice, add a pinch of salt and pepper, and whisk with a fork until the dressing looks blended and uniform.

  13. 13

    Fluff the cooked quinoa with a fork to separate the grains, then divide it evenly between two serving bowls.

  14. 14

    Top each bowl with half of the roasted chickpeas, half of the cucumber slices, and half of the tomato halves, arranging them in small mounds on top of the quinoa.

  15. 15

    Drizzle the lemon-olive oil dressing evenly over both bowls, starting from the center and moving outward to coat all ingredients.

Tools you’ll need

  • sheet pan
  • paper towels
  • medium pot with lid
  • small bowl
  • fork
  • cutting board
  • knife (8-inch chef's knife)
  • spoon
  • citrus juicer or hands
  • whisk or fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.