Sheet Pan Sausage & Potatoes
Smoked sausage and baby potatoes roast together on one pan with Italian seasoning for a no-fuss weeknight dinner. Ready in under 25 minutes.
- Total time
- 25 min
- Servings
- 4
- Calories
- 410
- Protein
- 22g
comfortcasualamericanporkcrispytenderweeknightmain-dish
Ingredients
- 1 lb smoked sausage
- 1.5 lbs baby potatoes
- 2 tbsp olive oil
- 1 tsp italian seasoning
Instructions
- 1
Preheat oven to 425°F, then cut sausage into 2-inch pieces and halve large potatoes.
- 2
Toss sausage and potatoes with oil, Italian seasoning, salt, and pepper on a sheet pan.
- 3
Spread in a single layer and roast for 20 minutes, shaking the pan halfway through.
- 4
Potatoes should be golden and tender; sausage edges should be caramelized.
Tools you’ll need
- sheet pan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
