CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Raclette with Crispy Potatoes

Melted raclette cheese over roasted potatoes, mushrooms, and onions — no special equipment needed. Finish with a crack of black pepper and fresh herbs for a cozy French-inspired weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
16g
Sheet-Pan Raclette with Crispy Potatoes
comfortcozyfrenchvegetariancheesecrispymeltytender

Ingredients

  • 1.5 lbs baby potatoes, halved
  • 10 oz mushrooms, sliced 1/4-inch thick
  • 1 medium yellow onion, cut into 1-inch wedges
  • 3 tbsp olive oil
  • 10 oz raclette cheese, sliced 1/4-inch thick
  • 2 tbsp fresh thyme or parsley, chopped

Instructions

  1. 1

    Preheat oven to 425°F. Toss potatoes, mushrooms, and onion with oil, salt, and pepper on a large sheet pan.

  2. 2

    Spread in an even layer. Roast for 15 minutes until potatoes are mostly tender and edges start to brown.

  3. 3

    Pull the pan from the oven. Arrange raclette slices over the vegetables, covering most of the surface.

  4. 4

    Return to the oven for 2–3 minutes until cheese melts completely and edges just start to bubble.

  5. 5

    Remove from oven. Scatter fresh herbs and a pinch of black pepper over the top.

  6. 6

    Serve immediately while cheese is still molten.

Tools you’ll need

  • large sheet pan (16 x 12 inches minimum)
  • chef's knife
  • cutting board
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.