CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Orata with Lemon & Herbs

Whole branzino (or sea bream) roasted on a sheet pan with cherry tomatoes, olives, and fresh herbs — golden, tender, ready in 18 minutes. Pure Italian simplicity.

Total time
18 min
Servings
2
Calories
320
Protein
38g
Sheet-Pan Orata with Lemon & Herbs
elegantsimpleitalianfishtenderflakyweeknightdate-night

Ingredients

  • 2 fish (about 1 lb total) whole branzino (or sea bream), cleaned and gutted
  • 1 cup, halved cherry tomatoes
  • ½ cup Castelvetrano or green olives, pitted
  • 1 whole, sliced into thin rounds lemon
  • 2 tbsp, chopped fresh parsley and oregano (or Italian seasoning)
  • 3 tbsp olive oil

Instructions

  1. 1

    Preheat oven to 425°F. Pat the fish dry inside and out with paper towels.

  2. 2

    Arrange the tomatoes, olives, and lemon slices on a sheet pan. Drizzle with 1 tbsp oil and a pinch of salt.

  3. 3

    Rub the fish with remaining 2 tbsp oil. Season inside and out with salt, pepper, and half the herbs.

  4. 4

    Nestle the fish among the vegetables on the pan. Scatter remaining herbs over the top.

  5. 5

    Roast until the flesh is opaque and flakes easily at the thickest part, 12–14 minutes.

  6. 6

    Serve hot, drizzling pan juices over the fish and vegetables.

Tools you’ll need

  • sheet pan (13×18 inch)
  • paper towels
  • oven (preheated to 425°F)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.