Sheet-Pan Loukaniko with Peppers
Greek pork sausages caramelized with bell peppers, onions, and a hit of oregano—crispy edges, tender insides, done in 20 minutes on one pan. Serve with crusty bread to soak up the pan juices.
- Total time
- 20 min
- Servings
- 2
- Calories
- 380
- Protein
- 24g
comfortcasualgreekporkcrispytenderweeknightmain-dish
Ingredients
- 8 oz loukaniko (Greek pork sausages)
- 1 large red bell pepper, cut into 1-inch chunks
- 1 medium yellow onion, cut into thick wedges
- 2 tbsp olive oil
- 1 tsp dried oregano
- 2 cloves garlic, minced
Instructions
- 1
Preheat oven to 425°F. Toss sausages, pepper, onion, garlic, oregano, olive oil, salt, and pepper on a sheet pan.
- 2
Spread everything in a single layer. Roast for 15 minutes, shaking the pan halfway through, until sausages are golden and cooked through.
- 3
Remove from oven. The sausage edges should look caramelized and crispy, juices pooled in the pan.
- 4
Serve hot directly from the pan with crusty bread to catch the pan juices.
Tools you’ll need
- 18-inch sheet pan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
