CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet Pan Gochujang Beef & Scallions

Thin-sliced beef tossed in a sticky gochujang glaze with charred scallions and toasted sesame seeds. Salty, spicy, and ready in 20 minutes—the kind of dinner that photographs like a restaurant dish.

Total time
20 min
Servings
2
Calories
380
Protein
38g
Sheet Pan Gochujang Beef & Scallions
quickcasualkoreanbeeftendercrispyweeknightmain-dish

Ingredients

  • 1 lb beef sirloin or flank steak, thinly sliced
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp soy sauce
  • 1 tbsp honey
  • 1 tbsp sesame oil
  • 1 bunch scallions, cut into 2-inch pieces
  • 2 cloves garlic, minced
  • 2 tbsp sesame seeds (white or black)

Instructions

  1. 1

    Mix gochujang, soy sauce, honey, sesame oil, and minced garlic in a small bowl until smooth.

  2. 2

    Heat olive oil in a large sheet pan or skillet over medium-high until shimmering, about 90 seconds.

  3. 3

    Add beef slices in a single layer and sear without stirring for 2 minutes until edges brown.

  4. 4

    Stir the beef, add scallions, then pour the gochujang sauce over everything and toss for 1 minute.

  5. 5

    Scatter sesame seeds over the top and remove from heat.

  6. 6

    Serve immediately over rice or with steamed vegetables.

Tools you’ll need

  • 12-inch skillet or sheet pan
  • small bowl
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.