Sheet Pan Gnocchi with Mushrooms & Shallot
Tender gnocchi roasted with mushrooms and shallot on one pan—ready in under 20 minutes. Simple, savory, and completely weeknight-proof.
- Total time
- 18 min
- Servings
- 2
- Calories
- 320
- Protein
- 8g
comfortsimpleitalianvegetariantendercrispyweeknightpasta
Ingredients
- 1 lb gnocchi
- 10 oz mushrooms, halved or quartered if large
- 1 whole shallot, thinly sliced
- 3 tbsp olive oil
Instructions
- 1
Preheat oven to 425°F and line a sheet pan with parchment.
- 2
Toss gnocchi, mushrooms, and shallot with olive oil, salt, and pepper on the sheet pan.
- 3
Spread in a single layer and roast until mushroom edges brown and gnocchi is golden, ~12 minutes.
- 4
Remove from oven and taste—adjust salt and pepper as needed.
- 5
Serve hot straight from the pan.
Tools you’ll need
- sheet pan
- parchment paper
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
