Sheet Pan Bratwurst with Sauerkraut & Fried Onions
Sausages and tangy sauerkraut roast together on one pan while potatoes crisp up with fried onions on the side. Mustard ties it all together in under 25 minutes.
- Total time
- 25 min
- Servings
- 2
- Calories
- 620
- Protein
- 28g
comfortheartygermanporkcrispytenderweeknightmain-dish
Ingredients
- 4 links bratwurst
- 2 cups sauerkraut, drained
- 3 tbsp mustard
- 2 cups mashed potatoes
- ½ cup fried onions (store-bought)
Instructions
- 1
Preheat oven to 400°F and place bratwurst on a sheet pan.
- 2
Spread sauerkraut around the sausages and drizzle with 1 tbsp oil.
- 3
Roast for 18–20 minutes until sausages are golden and cooked through.
- 4
Warm mashed potatoes in a bowl or microwave for 2 minutes while sausages finish.
- 5
Top potatoes with fried onions, then plate alongside the bratwurst and sauerkraut.
- 6
Serve with mustard on the side or smeared on the sausages.
Tools you’ll need
- sheet pan
- oven
- bowl or microwave-safe container
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
