CookSnap is coming soon — Join the waitlist →
Back to recipes

Sesame Soba Noodle Salad with Soft Eggs

Nutty buckwheat noodles tossed with a bright sesame-ginger dressing, topped with hard-boiled egg wedges and fresh scallions. A light, protein-packed meal that comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
14g
Sesame Soba Noodle Salad with Soft Eggs
lightfreshjapanesevegetarianeggstenderchewyweeknight

Ingredients

  • 8 oz soba noodles
  • 2 large hard-boiled eggs
  • 1 tbsp fresh ginger, minced
  • 3 tbsp sesame oil
  • 2 tbsp rice vinegar
  • 2 tbsp soy sauce
  • 3 whole scallions, sliced
  • 1 tbsp sesame seeds (white or black)

Instructions

  1. 1

    Boil soba noodles in salted water until tender, about 4 minutes. Drain and rinse under cold water until cool.

  2. 2

    Whisk together sesame oil, rice vinegar, soy sauce, and minced ginger in a large bowl.

  3. 3

    Add cooled noodles to the dressing and toss until every strand is coated.

  4. 4

    Divide noodles between two bowls. Cut hard-boiled eggs into wedges and arrange on top.

  5. 5

    Scatter scallions and sesame seeds over each bowl. Serve immediately.

Tools you’ll need

  • large pot
  • colander
  • large mixing bowl
  • whisk
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.