CookSnap is coming soon — Join the waitlist →
Back to recipes

Cold Soba Noodle Salad

A refreshing Japanese noodle salad with a tangy-savory dressing, crisp vegetables, and nutty soba. Ready in under 25 minutes—perfect for lunch or a light dinner.

Total time
25 min
Servings
2
Calories
380
Protein
12g
Cold Soba Noodle Salad
freshlightjapanesevegetarianvegetarianchewycrispweeknight

Ingredients

  • 6 oz soba noodles (buckwheat)
  • 1 medium cucumber
  • 2 medium carrots
  • 3 tablespoons soy sauce
  • 1.5 tablespoons rice vinegar
  • 1 tablespoon sesame oil

Instructions

  1. 1

    Fill a large pot with water and bring to a rolling boil over high heat, about 8 minutes. You'll hear vigorous bubbling and see steam rising from the surface.

  2. 2

    While water heats, slice the cucumber lengthwise into quarters from end to end, then rotate each quarter and cut crosswise into thin half-moons, about 1/8 inch thick.

  3. 3

    Peel each carrot with a vegetable peeler, then use the peeler to shave the carrot lengthwise into long, thin ribbons about 1/8 inch thick.

  4. 4

    Add the soba noodles to the boiling water and stir once with a wooden spoon to separate them, then boil uncovered until tender, about 4 minutes, or per package directions.

  5. 5

    Pour the noodles into a colander and rinse under cold running water for 20 seconds, stirring gently with your fingers until they feel cool to the touch and are no longer sticky.

  6. 6

    In a small bowl, whisk together the soy sauce, rice vinegar, and sesame oil until the oil is fully combined, about 10 seconds—the mixture should look glossy and uniform.

  7. 7

    Transfer the cooled noodles to a serving bowl or two individual bowls, then arrange the cucumber and carrot ribbons on top in small piles.

  8. 8

    Pour the dressing evenly over the noodles and vegetables, then toss everything together with two forks, lifting and turning until the noodles are evenly coated.

Tools you’ll need

  • large pot
  • colander
  • vegetable peeler
  • cutting board
  • chef's knife
  • small bowl
  • whisk
  • serving bowl or 2 individual bowls
  • 2 forks

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.