CookSnap is coming soon — Join the waitlist →

Barolo Beef Risotto

Tender beef braised in bold Barolo wine, stirred into creamy risotto for an elegant one-pot dinner. Rich, earthy, and deeply satisfying.

Total time
50 min
Servings
4
Calories
680
Protein
38g
Barolo Beef Risotto
elegantcomfortitalianbeefcreamytenderweeknightdate-night

Ingredients

  • 1 lb beef chuck, cut into 1-inch cubes
  • 1.5 cups Barolo wine
  • 1.5 cups arborio rice
  • 4 cups beef broth
  • 1 medium yellow onion, diced
  • 3 cloves garlic, minced
  • ¾ cup parmesan cheese, grated
  • 3 tbsp butter
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Heat 1 tbsp butter in a heavy pot over medium-high heat until foaming.

  2. 2

    Sear beef in batches without stirring until deep brown on all sides, ~8 minutes total. Transfer to a plate.

  3. 3

    Add onion to the pot and sauté until softened, ~4 minutes. Stir in garlic; cook until fragrant, ~30 seconds.

  4. 4

    Pour in Barolo, scraping up any browned bits. Return beef to the pot. Simmer covered for 30 minutes until beef is tender.

  5. 5

    Warm broth in a separate pot. Stir rice into the beef mixture and cook, stirring constantly, for 2 minutes.

  6. 6

    Add broth one ladle at a time, stirring frequently. Wait until liquid is mostly absorbed before adding more.

  7. 7

    After 18 minutes, rice should be creamy but still have a slight bite. Stir in remaining 2 tbsp butter and parmesan.

  8. 8

    Season with salt and pepper. Serve immediately in shallow bowls.

Tools you’ll need

  • heavy-bottomed pot with lid (5-quart minimum)
  • separate saucepan for broth
  • wooden spoon
  • ladle
  • cutting board
  • chef's knife
  • grater for parmesan

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.