Custrd is out on the App Store — Download it free →
Back to recipes

Seared Fish Fillet with Pea Puree and Yellow Sauce

A quick and elegant weeknight dinner: crispy-skinned fish fillet over a sweet pea puree, finished with a vibrant yellow sauce and a sprinkle of red pepper flakes.

Total time
30 min
Servings
4
Calories
350
Protein
35g
Seared Fish Fillet with Pea Puree and Yellow Sauce
elegantcomfortingamericangluten-freefishcrispycreamyweeknight dinner

Ingredients

  • 4 filets white fish fillets
  • 2 cups frozen peas
  • ½ cup plain yogurt
  • 1 teaspoon turmeric
  • 3 tablespoons olive oil
  • 1 teaspoon salt
  • ½ teaspoon black pepper
  • 1 teaspoon red pepper flakes

Instructions

  1. 1

    Pat the 4 fish fillets dry and season both sides with 1/2 tsp salt and 1/4 tsp black pepper.

  2. 2

    In a blender, combine 2 cups peas, 1/2 cup yogurt, 1/2 tsp salt, and 1/4 tsp black pepper. Blend until smooth, about 1 minute.

  3. 3

    In a small bowl, mix 1/2 cup yogurt, 1 tsp turmeric, and a pinch of salt to make the yellow sauce.

  4. 4

    Heat 2 tbsp olive oil in a large skillet over medium-high. Place the fish skin-side down and cook until the skin is crispy and golden, about 4 minutes.

  5. 5

    Flip the fish and cook for another 2-3 minutes, until the flesh is opaque and flakes easily with a fork.

  6. 6

    Spread the pea puree on plates, top with the fish, drizzle with the yellow sauce, and sprinkle with 1 tsp red pepper flakes and the remaining 1 tbsp olive oil.

  7. 7

    Garnish with microgreens if desired and serve immediately.

Tools you’ll need

  • blender
  • large skillet
  • small bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.