CookSnap is coming soon — Join the waitlist →

20-Min Seafood Meatball Stew with Caper Sauce

German-inspired fish meatballs in a tangy caper-anchovy sauce, ready in 20 minutes. Cozy, bright, and nothing like the classical version — this one actually fits weeknight timing.

Total time
20 min
Servings
2
Calories
385
Protein
42g
20-Min Seafood Meatball Stew with Caper Sauce
comfortcozygermanfishtendercreamyweeknightstew

Ingredients

  • 12 oz cod or halibut fillets
  • ⅓ cup panko breadcrumbs
  • 1 whole egg
  • 3 tbsp capers in brine, drained
  • 1 tbsp anchovy paste or fillets, minced
  • ½ cup heavy cream or sour cream
  • 1 cup beef or fish stock

Instructions

  1. 1

    Pulse fish fillets in a food processor until roughly chopped but not fully pureed — should look chunky.

  2. 2

    Transfer fish to a bowl. Mix in breadcrumbs, egg, 1 tbsp capers (minced), anchovy paste, salt, and pepper until just combined.

  3. 3

    Heat oil in a 10-inch skillet over medium-high. Shape fish mixture into 8–10 balls, then pan-fry 3–4 minutes per side until golden brown and cooked through.

  4. 4

    Pour stock into the skillet around the meatballs, scraping up any browned bits. Bring to a simmer over medium heat for 2 minutes.

  5. 5

    Stir in cream and remaining capers. Simmer 2–3 minutes until the sauce thickens slightly and coats the meatballs.

  6. 6

    Season with salt and pepper. Serve over egg noodles or boiled potatoes, spooning the sauce over the top.

Tools you’ll need

  • food processor
  • 10-inch skillet or sauté pan
  • wooden spoon
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.