CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Salt Cod & Potato Skillet

Salted cod transforms into tender, flaky fish in a silky cream sauce with potatoes and garlic. A Portuguese classic streamlined for weeknight cooking.

Total time
18 min
Servings
2
Calories
425
Protein
38g
Creamy Salt Cod & Potato Skillet
comfortcozyportuguesefishcreamytenderflakyweeknight

Ingredients

  • ¾ lb salt cod fillets (pre-soaked), skin removed
  • ½ lb waxy potatoes (yukon gold or similar)
  • ¾ cup heavy cream
  • 3 whole garlic cloves, minced
  • 1 whole bay leaf
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Slice potatoes into 1/4-inch rounds. Heat 2 tbsp olive oil in a 12-inch skillet over medium-high until shimmering.

  2. 2

    Add potatoes and cook without stirring for 3 minutes until edges start to soften and bottom layer browns lightly.

  3. 3

    Stir in garlic and cook 30 seconds until fragrant, then add cream and bay leaf.

  4. 4

    Nestle cod fillets into the cream sauce. Cover and simmer 6 minutes until fish flakes easily with a fork.

  5. 5

    Season with salt and pepper to taste. Discard bay leaf. Scatter parsley over the top.

  6. 6

    Serve immediately in the skillet or divide between bowls.

Tools you’ll need

  • 12-inch skillet with lid
  • cutting board
  • chef's knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.