Custrd is out on the App Store — Download it free →
Back to recipes

Savory Pastry with Ground Meat Filling

Flaky pastry pockets filled with seasoned ground meat, topped with crunchy breadcrumbs. A comforting, easy dinner that comes together in under an hour.

Total time
45 min
Servings
6
Calories
480
Protein
18g
Savory Pastry with Ground Meat Filling
comfortingMiddle Easternbeefflakycrispyweeknightpastrydinner

Ingredients

  • 1 package (17.3 oz) puff pastry sheets
  • 1 lb ground beef
  • 1 medium onion
  • ½ cup breadcrumbs
  • 1 large egg
  • 2 tbsp olive oil
  • 1 tsp salt
  • ½ tsp black pepper

Instructions

  1. 1

    Preheat oven to 400°F. Thaw puff pastry according to package directions if frozen.

  2. 2

    Heat 2 tbsp olive oil in a skillet over medium heat. Add 1 diced onion and cook until soft and golden, about 6 minutes.

  3. 3

    Add 1 lb ground beef to the skillet. Cook, breaking it up, until browned and no longer pink, about 8 minutes. Season with 1 tsp salt and 0.5 tsp black pepper.

  4. 4

    Remove from heat and stir in 0.5 cup breadcrumbs and 1 beaten egg until well combined. Let cool slightly.

  5. 5

    Roll out puff pastry on a floured surface. Cut into 6 squares. Place a spoonful of filling in the center of each square.

  6. 6

    Fold pastry over to form triangles, press edges with a fork to seal. Place on a baking sheet lined with parchment paper.

  7. 7

    Brush tops with beaten egg (optional) and sprinkle with extra breadcrumbs. Bake until golden and puffed, 20-25 minutes. Let cool 5 minutes before serving.

Tools you’ll need

  • skillet
  • baking sheet
  • parchment paper
  • rolling pin
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.