20-Min Sausage Penne
Browned Italian sausage simmered with marinara, tossed with penne and finished with a hit of parmesan. Weeknight comfort in one skillet.
- Total time
- 20 min
- Servings
- 4
- Calories
- 680
- Protein
- 38g
comfortamericanporktendercreamyweeknightpastadinner
Ingredients
- 1 lb Italian sausage, bulk or casings removed
- 24 oz marinara sauce
- 1 lb penne pasta
- ½ cup parmesan cheese, grated
Instructions
- 1
Boil salted water in a large skillet over high heat, then add penne and cook until al dente, ~9 minutes.
- 2
While pasta cooks, brown sausage in a separate skillet over medium-high, breaking it apart with a spoon, ~5 minutes.
- 3
Pour marinara into the sausage skillet and simmer for 3 minutes until fragrant.
- 4
Drain pasta, transfer to the sausage skillet, and toss until coated.
- 5
Top each serving with a generous handful of parmesan and serve hot.
Tools you’ll need
- large skillet or large pot
- separate medium skillet
- wooden spoon
- colander
- tongs or long spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
