Custrd is out on the App Store — Download it free →
Back to recipes

Satay with Peanut Sauce and Vegetables

Quick chicken skewers with a creamy peanut sauce, served with boiled eggs and green beans for a fast, satisfying meal.

Total time
25 min
Servings
4
Calories
420
Protein
35g
Satay with Peanut Sauce and Vegetables
comfortingSoutheast Asiangluten-freechickentendercrispweeknightmain

Ingredients

  • 1 lb chicken breast
  • ½ cup peanut butter
  • 3 tbsp soy sauce
  • ½ lb green beans
  • 4 eggs
  • 1 lime

Instructions

  1. 1

    Cut the 1 lb chicken breast into 1-inch cubes and thread onto skewers. Season with salt and pepper.

  2. 2

    In a small bowl, whisk together the 1/2 cup peanut butter, 3 tbsp soy sauce, juice of 1 lime, and 1/4 cup water until smooth.

  3. 3

    Boil the 4 eggs for 8 minutes, then cool and peel. Blanch the 1/2 lb green beans in boiling water for 3 minutes until bright green and crisp-tender.

  4. 4

    Grill or pan-sear the chicken skewers over medium-high heat, turning occasionally, until golden and cooked through, about 8-10 minutes.

  5. 5

    Serve the skewers with the peanut sauce, eggs, and green beans. Drizzle extra sauce over everything.

Tools you’ll need

  • skewers
  • grill or skillet
  • pot
  • bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.