CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sarawak Laksa

Rich coconut broth with laksa paste, egg noodles, shrimp, and chicken in one pot. Tangy, spicy, and deeply savory — Malaysia on a plate in 20 minutes.

Total time
20 min
Servings
2
Calories
485
Protein
38g
Sarawak Laksa
comfortboldmalaysianshrimpchickentenderchewyweeknight

Ingredients

  • 3 tbsp laksa paste (or red curry paste)
  • 1 can (13.5 oz) coconut milk (canned)
  • 1.5 cups chicken or shrimp stock
  • ½ lb shrimp (medium, peeled)
  • 1 cup rotisserie chicken, shredded
  • 6 oz egg noodles (or rice noodles)
  • 1 whole lime (juiced) + fresh cilantro or green onion
  • ½ cup bean sprouts (fresh or canned)

Instructions

  1. 1

    Bring a large pot of salted water to boil. Add noodles, stir, and cook until al dente, ~5 minutes. Drain and set aside.

  2. 2

    In the same pot, heat 1 tbsp oil over medium heat. Stir in laksa paste until fragrant, about 60 seconds.

  3. 3

    Pour in coconut milk and stock. Bring to a simmer, stirring to blend the paste.

  4. 4

    Add shrimp and shredded chicken. Simmer until shrimp turn pink, about 4 minutes.

  5. 5

    Divide noodles between two bowls. Ladle broth, shrimp, and chicken over the top.

  6. 6

    Squeeze lime juice over each bowl. Top with bean sprouts and fresh cilantro or green onion. Serve hot.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander
  • two serving bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.