CookSnap is coming soon — Join the waitlist →

25-Minute Laksa with Prawns & Rice Noodles

Creamy coconut curry broth simmered with fresh prawns, rice noodles, and aromatic spices—restaurant-quality laksa on a weeknight. Ginger, turmeric, and chili paste build a bold, complex base that comes together in under 20 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
28g
25-Minute Laksa with Prawns & Rice Noodles
comfortboldmalaysianshrimptendersilkyweeknightsoup

Ingredients

  • 8 oz rice noodles
  • 1 lb large prawns, peeled and deveined
  • 1 can coconut milk (13.5 oz can)
  • 3 tbsp red curry paste (or laksa paste)
  • 1 tbsp fresh ginger, minced
  • 2 cups chicken or seafood broth
  • 1 whole lime (juiced)
  • ¼ cup fresh cilantro and scallions, chopped

Instructions

  1. 1

    Boil rice noodles in salted water until tender, about 4 minutes. Drain and divide among four bowls.

  2. 2

    Heat 1 tbsp oil in a large pot over medium-high. Add ginger and curry paste, stirring constantly, until fragrant, about 60 seconds.

  3. 3

    Pour in broth and coconut milk. Bring to a gentle simmer and cook for 4 minutes to meld flavors.

  4. 4

    Add prawns and cook until pink throughout and opaque, 3–4 minutes. Squeeze in lime juice and taste for salt.

  5. 5

    Ladle broth and prawns over noodles in each bowl. Garnish with cilantro and scallions, then serve immediately.

Tools you’ll need

  • large pot (4-quart minimum)
  • wooden spoon or spatula
  • colander
  • four serving bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.