CookSnap is coming soon — Join the waitlist →

10-Min Laksa Bowl with Shrimp

Tangy, spicy laksa broth built on laksa paste and coconut milk, topped with tender shrimp and rice noodles. Ready in under 20 minutes—the shortcut version that tastes like you simmered for hours.

Total time
18 min
Servings
2
Calories
380
Protein
32g
10-Min Laksa Bowl with Shrimp
comfortboldmalaysianshrimptendersilkyweeknightsoup

Ingredients

  • 3 tbsp laksa paste
  • 1 can (13.5 oz) coconut milk, full-fat
  • 1 tbsp fish sauce
  • 2 tbsp lime juice
  • ¾ lb shrimp, large, peeled
  • 4 oz rice noodles, thin
  • ½ medium cucumber, sliced thin

Instructions

  1. 1

    Bring 3 cups water to a boil in a pot. Stir in laksa paste until dissolved, about 30 seconds.

  2. 2

    Pour in coconut milk and fish sauce. Stir and simmer for 4 minutes until broth turns fragrant and golden.

  3. 3

    Cook rice noodles in boiling salted water until tender, about 4 minutes. Drain and divide between two bowls.

  4. 4

    Add shrimp to the broth and cook until pink throughout, about 3 minutes—don't stir constantly.

  5. 5

    Squeeze lime juice into the broth and taste—add salt or fish sauce if needed.

  6. 6

    Pour broth and shrimp over noodles. Top with cucumber slices and serve immediately.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.