CookSnap is coming soon — Join the waitlist →
Back to recipes

10-Min Sambal Squid Over Coconut Rice

Crispy pan-fried squid tossed in fiery sambal paired with buttery coconut rice. One skillet, 10 minutes, pure Malaysian comfort.

Total time
10 min
Servings
2
Calories
385
Protein
26g
10-Min Sambal Squid Over Coconut Rice
quickindulgentmalaysiansquidcrispytenderweeknightmain-dish

Ingredients

  • 2 cups cooked jasmine rice (or pre-cooked coconut rice)
  • ¾ lb squid, cleaned and cut into rings
  • 3 tbsp sambal oelek or chili paste
  • ¼ cup coconut milk
  • 1 whole lime (zested + juiced)
  • 2 whole shallots, thinly sliced
  • 2 tbsp neutral oil for cooking

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering. Add shallots, cook for 1 minute until fragrant.

  2. 2

    Stir in sambal and coconut milk, cooking for 30 seconds until aromatic and glossy.

  3. 3

    Add squid rings and cook, stirring constantly, until opaque and just tender, about 3 minutes. Don't overcook.

  4. 4

    Squeeze lime juice into the pan, add lime zest, and toss gently until coated.

  5. 5

    Divide warm rice between bowls and top with sambal squid and all sauce.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • cutting board
  • knife
  • microplane (for lime zest)
  • bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →