Custrd is out on the App Store — Download it free →
Back to recipes

Rugelach

Crescent-shaped cookies with a flaky cream cheese dough and a sweet jam filling, dusted with powdered sugar.

Total time
120 min
Servings
12
Calories
280
Protein
3g
Rugelach
festiveJewishvegetariandairyflakytenderholidaycookie

Ingredients

  • 2 cups all-purpose flour
  • 1 cup unsalted butter
  • 8 oz cream cheese
  • ¼ cup granulated sugar
  • ½ cup jam (any flavor)
  • ¼ cup powdered sugar

Instructions

  1. 1

    In a food processor, pulse 2 cups flour, 1 cup cold butter (cut into pieces), and 8 oz cold cream cheese until dough just comes together. Shape into a disk, wrap, and chill 1 hour.

  2. 2

    On a floured surface, roll the dough into a 12-inch circle. Spread 0.5 cup jam evenly over the dough, leaving a 1-inch border.

  3. 3

    Cut the circle into 12 wedges like a pizza. Roll each wedge from the wide end to the point, then place on a parchment-lined baking sheet, point-side down.

  4. 4

    Chill the rugelach for 30 minutes. Meanwhile, preheat oven to 350°F.

  5. 5

    Bake until golden brown, about 20-25 minutes. Let cool on the sheet for 5 minutes, then transfer to a rack.

  6. 6

    Dust with 0.25 cup powdered sugar while still warm. Serve at room temperature.

Tools you’ll need

  • food processor
  • rolling pin
  • baking sheet
  • parchment paper
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.