Custrd is out on the App Store — Download it free →
Back to recipes

Roast Chicken with Lemon and Potatoes

A simple one-pan roast chicken with crispy potatoes and bright lemon, perfect for a weeknight dinner.

Total time
45 min
Servings
4
Calories
450
Protein
30g
Roast Chicken with Lemon and Potatoes
comfortingAmericangluten-freechickencrispytenderweeknightmain course

Ingredients

  • 4 whole chicken thighs
  • 4 medium potatoes
  • 1 whole lemon
  • 2 tbsp olive oil
  • 1 tsp dried oregano
  • 2 cloves garlic
  • 1 tsp salt
  • ½ tsp black pepper

Instructions

  1. 1

    Preheat oven to 425°F. Cut 4 medium potatoes into wedges and place in a large baking dish. Drizzle with 1 tbsp olive oil, sprinkle with 1/2 tsp salt and 1/4 tsp pepper, toss to coat.

  2. 2

    Pat 4 chicken thighs dry with paper towels. Rub with remaining 1 tbsp olive oil, 1 tsp dried oregano, 1/2 tsp salt, and 1/4 tsp pepper.

  3. 3

    Slice 1 lemon into rounds. Arrange chicken over potatoes, tuck lemon slices and 2 smashed garlic cloves around the pan.

  4. 4

    Roast for 30-35 minutes, until chicken skin is golden and crispy and potatoes are tender when pierced with a fork.

  5. 5

    Let rest 5 minutes. Spoon pan juices over everything before serving.

Tools you’ll need

  • Baking dish
  • Knife
  • Cutting board
  • Measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.