CookSnap is coming soon — Join the waitlist →

15-Min Rendang Beef Skillet

Spiced coconut beef that tastes like a 2-hour braise but happens in one skillet in 10 minutes. Use rendang paste as the anchor—it does the heavy lifting so you don't have to.

Total time
15 min
Servings
4
Calories
385
Protein
38g
15-Min Rendang Beef Skillet
comfortsatisfyingindonesianbeeftendersilkyweeknightmain-dish

Ingredients

  • 1.25 lbs beef chuck or sirloin, thinly sliced
  • 4 tbsp rendang paste
  • 1 can (13.5 oz) coconut milk (full-fat)
  • 2 medium shallots, sliced thin
  • 2 tbsp lime juice
  • 1 tbsp palm sugar or brown sugar
  • ¼ cup fresh cilantro, chopped (optional)

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over high heat until shimmering, about 60 seconds.

  2. 2

    Brown half the beef, stirring occasionally, until no pink remains on the outside, ~3 minutes. Transfer to a plate and repeat with remaining beef.

  3. 3

    Lower heat to medium. Add shallots to the skillet and cook, stirring, until soft and fragrant, about 90 seconds.

  4. 4

    Stir in rendang paste and cook for 30 seconds until fragrant.

  5. 5

    Pour in coconut milk, then return beef to the skillet. Add sugar and lime juice, stir gently until combined.

  6. 6

    Simmer 2–3 minutes until beef is cooked through and sauce clings to the meat. Top with cilantro and serve.

Tools you’ll need

  • large skillet (12-inch or larger)
  • wooden spoon or silicone spatula
  • plate for transferring meat

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.