Ravioli Lasagna Bake
Layered cheese ravioli with marinara and melted mozzarella, baked until bubbly in under 25 minutes. Serve with a side salad for a complete weeknight dinner.
- Total time
- 25 min
- Servings
- 4
- Calories
- 485
- Protein
- 22g
comforteasyitalianvegetariancreamymeltyweeknightpasta
Ingredients
- 1 lb frozen or fresh cheese ravioli
- 2 cups marinara sauce
- 2 cups shredded mozzarella cheese
Instructions
- 1
Preheat oven to 400°F and lightly oil a 9x13-inch baking dish.
- 2
Spread 0.5 cups marinara on the dish bottom, then layer half the ravioli over it.
- 3
Add 1 cup marinara and 1 cup mozzarella over the ravioli layer.
- 4
Layer remaining ravioli, then top with remaining marinara and mozzarella.
- 5
Bake uncovered for 15–18 minutes until cheese melts and edges bubble.
- 6
Cool 2 minutes, then serve with green salad alongside.
Tools you’ll need
- 9x13-inch baking dish
- oven
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
