CookSnap is coming soon — Join the waitlist →
Back to recipes

Quick Shrimp Tacos with Lime Crema

Crispy pan-seared shrimp seasoned with cumin and chili powder, served in warm tortillas with a tangy lime crema and fresh toppings. Ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
398
Protein
24g
Quick Shrimp Tacos with Lime Crema
freshquickmexicanshrimpcrispytenderweeknighttaco

Ingredients

  • ¾ lb large shrimp, peeled and deveined
  • ¾ tsp cumin
  • ½ tsp chili powder
  • ⅓ cup sour cream
  • 1 whole lime (juiced and zested)
  • 6 whole corn tortillas, 6-inch
  • 1 cup cabbage, shredded (or use pre-shredded coleslaw mix)
  • ¼ cup fresh cilantro or parsley, chopped

Instructions

  1. 1

    Pat the shrimp dry with paper towels, pressing gently on each one until no moisture remains on the surface, so they will sear instead of steam.

  2. 2

    In a small bowl, stir together the cumin, chili powder, salt, and pepper until evenly mixed.

  3. 3

    In another small bowl, whisk together the sour cream, lime juice, and lime zest until smooth and uniform.

  4. 4

    Heat 1 tablespoon of olive oil in a large skillet over medium-high heat until it shimmers and moves quickly when you tilt the pan, about 90 seconds.

  5. 5

    Sprinkle the cumin-chili mixture evenly over the shrimp, then add them to the hot skillet in a single layer.

  6. 6

    Cook the shrimp without moving them for 2 minutes until the bottoms turn opaque and coral-colored, then flip each one over.

  7. 7

    Cook for 1 more minute on the second side until the shrimp are fully opaque and curled, then transfer to a clean plate.

  8. 8

    Warm the tortillas one at a time directly over a gas flame for 15 seconds per side until soft and pliable, or wrap all 6 in foil and warm in a 350°F oven for 5 minutes.

  9. 9

    Lay one warm tortilla on a plate and spread 1 tablespoon of the lime crema down the center.

  10. 10

    Top with 3 to 4 shrimp, then add a small handful of shredded cabbage on top of the shrimp.

  11. 11

    Sprinkle chopped cilantro over the cabbage, then repeat with remaining tortillas and toppings to make 6 tacos total.

Tools you’ll need

  • paper towels
  • 2 small bowls
  • whisk
  • large skillet (12-inch recommended)
  • kitchen tongs or spatula
  • clean plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.