CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Pumpkin Tortelli with Brown Butter

Tender store-bought tortelli filled with roasted pumpkin, topped with nutty brown butter and crispy sage. A weeknight take on the Northern Italian classic that tastes fancy but takes less than 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
18g
20-Min Pumpkin Tortelli with Brown Butter
elegantsimpleitalianvegetarianvegetariantendercreamyweeknight

Ingredients

  • 300 g cheese tortelli, frozen (pumpkin or butternut squash filling)
  • 4 tbsp butter
  • 8 leaves fresh sage leaves
  • ½ cup parmesan, finely grated
  • 1 pinch salt
  • 1 pinch black pepper
  • ½ lemon lemon, zested

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add tortelli and stir once to prevent sticking.

  2. 2

    While water heats, melt butter in a large skillet over medium. Add sage leaves and cook until fragrant, about 1 minute.

  3. 3

    Continue cooking butter, swirling occasionally, until it turns golden brown with a nutty aroma, 3–4 minutes total.

  4. 4

    When tortelli float and hold steady for 1 minute, they're done. Reserve 1/2 cup pasta water, then drain.

  5. 5

    Transfer tortelli to the brown butter skillet. Toss gently and add 2 tbsp pasta water to create a silky glaze.

  6. 6

    Divide into bowls. Top with parmesan, lemon zest, and a crack of black pepper. Serve immediately.

Tools you’ll need

  • large pot (4+ quart)
  • large skillet (12-inch)
  • wooden spoon
  • slotted spoon
  • microplane or zester

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Italian recipes →