CookSnap is coming soon — Join the waitlist →
Back to recipes

Butter-Sage Tortelli di Zucca

Fresh pumpkin tortelli tossed in a silky brown-butter sauce with crispy sage. A 15-minute weeknight pasta that tastes like a long, slow kitchen afternoon.

Total time
15 min
Servings
2
Calories
385
Protein
14g
Butter-Sage Tortelli di Zucca
elegantcomfortitalianvegetarianvegetariantendermeltyweeknight

Ingredients

  • 14 oz fresh tortelli di zucca (pumpkin-filled pasta)
  • 4 tbsp butter
  • 12 leaves fresh sage leaves
  • 1 clove garlic clove, minced
  • ½ whole lemon
  • 2 tbsp Parmigiano-Reggiano, grated

Instructions

  1. 1

    Bring a pot of salted water to a rolling boil.

  2. 2

    Add tortelli and cook until they float, then another minute—until edges look tender.

  3. 3

    While they cook, melt butter in a skillet over medium, add garlic and cook until fragrant, 30 seconds.

  4. 4

    Add sage leaves and let them crisp, stirring, until edges darken, about 1 minute.

  5. 5

    Drain tortelli, add to skillet, and gently toss until coated—butter should look foamy and nutty.

  6. 6

    Divide between bowls, grate lemon zest over top, finish with Parmigiano-Reggiano, squeeze lemon juice.

Tools you’ll need

  • large pot
  • 12-inch skillet or saucepan
  • microplane or zester
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Italian recipes →